| CAT No.BT-PRO-291 |
| Early Secretory Target Mycobacterium Tuberculosis Recombinant, ESAT6, 50ug |
Amino Acid Composition
AEQQWNFAGIEAAASAIQGNVTSIHSLLDEGKQSLTKLAAAWGGSG
SEAYQGVQQKWDATATELNNALQNLARTISEAGQAMASTEGNVTGMF
AKLAAALEHHHHHH.
Description
ESAT-6 Recombinant produced in e.coli is a single, non-glycosylated, polypeptide having a total molecular mass of 11261.35 Dalton.
The ESAT-6 contains 6 additional amino acid residues - His-Tag.
Formulation
The protein (1mg/ml) was lyophilized after from a sterile solution containing 50mM Tris-HCl, pH 8.0, 1mM EDTA and 1mM DTT.
The sale and/or commercial use of Recombinant ESAT-6 is prohibited in the United States of America (U.S.A), Canada, Great Britain, Denmark, France, Greece, Italy, Germany, Spain, Ireland, Portugal, New Zealand and Australia.
Physical Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.
Purity
Greater than 95.0% as determined by(a) Analysis by RP-HPLC.
(b) Analysis by SDS-PAGE.
Solubility
It is recommended to reconstitute the lyophilized ESAT-6 in sterile 18M¦¸-cm H2O not less than 100ug/ml, which can then be further diluted to other aqueous solutions.
Source
Escherichia Coli.
Stability
Lyophilized ESAT-6 although stable at room temperature for 3 weeks, should be stored desiccated below -18¡ãC. Upon reconstitution ESAT-6 should be stored at 4¡ãC between 2-7 days and for future use below
-18¡ãC.
For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Please prevent freeze-thaw cycles.
Synonyms
Early Secretory Target Mycobacterium Tuberculosis, ESAT-6.
Usage
TSZGENE's products are furnished for LABORATORY RESEARCH USE ONLY. They may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
