| CAT No.BT-HBS-874 |
| Hepatitis B Surface Antigen, preS2 Recombinant, HBsAg preS2, 50ug |
Amino Acid Sequence
MQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPN.
Applications
1. Immunochromatography (capture and conjugate).
2. Preparing monoclonal or polyclonal antibodies for HBsAg-preS2.
3. ELISA.
Description
The E.coli derivedRecombinant Hepatitis B Surface Antigen preS2 is a single non-glycosylated polypeptide chain containing 55 amino acids & having a molecular weight of5.7 kDa.
HBsAg protein was lyophilized from 0.2¦Ìm filtered (1mg/ml) solution in 20mM PB, pH 7.4 and 50mM NaCl.
Purification Method
HBsAg protein was purified by proprietary chromatographic technique.
Purity
HBsAg protein is >95% pure as determined by 10% PAGE (coomassie staining).
Solubility
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at <-20¡ãC. Further dilutions should be made in appropriate buffered solutions.
Storage
This lyophilized preparation is stable at 2-8¡ãC, but should be kept at
-20¡ãC for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8¡ãC. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20¡ãC to -70¡ãC.
Avoid repeated freeze/thaw cycles.
