| CAT No.BT-CYT-407 |
| Heregulin-B2 Human Recombinant, NRG1 Human, 50ug |
Introduction
Neuregulin is a signaling protein for ErbB2/ErbB4 receptor heterodimers on the cardiac muscle cells, playing an important role in heart structure and function through inducing ErbB2/ErbB4 receptor phosphorylation and cardiomyocyte differentiation. Research on molecular level discovered that neuregulin recombinant could make disturbed myocardial cell structure into order and strengthen the connection between myocardial cells by intercalated discs re-organization. Pharmacodynamic experiments in animals showed that neuregulin (NRG1) recombinant can reduce the degree of damage on myocardial cells caused by ischemia, hypoxia and viral infection.
Amino acid sequence
shlvkcaekektfcvnggecfmvkdlsnpsrylckcpneftgdrcqnyvmasfykaeelyq.
Biological Activity
The activity measured by its ability to stimulate the proliferation of human MCF-7 cells grown under serum-free conditions corresponding to a specific activity of 12,000 Units/mg.
Recombinant Human Neuregulin-1 beta 2 produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 61 amino acids and having a total molecular mass of 7055 Dalton.
NRG-1 is purified by proprietary chromatographic techniques.
Formulation
Lyophilized from a 0.2¦Ìm filtered solution (0.25mg/ml) in 20mM PB, pH 7.0, containing 0.5%HSA and 2% mannitol.
Physical Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.
Purity
Greater than 96.0% as determined by(a) Analysis by RP-HPLC.
(b) Analysis by SDS-PAGE.
Solubility
It is recommended to reconstitute the lyophilized NRG1 in sterile 18M¦¸-cm H2O not less than 100ug/ml, which can then be further diluted to other aqueous solutions.
Source
Escherichia Coli.
Stability
Lyophilized NRG1 although stable at room temperature for 3 weeks, should be stored desiccated below -18¡ãC. Upon reconstitution Heregulin should be stored at 4¡ãC between 2-7 days and for future use below -18¡ãC.
Please prevent freeze-thaw cycles.
Synonyms
Neuregulin-1, NRG1, GGF, HGL, HRGA, NDF, SMDF, HRG, ARIA, GGF2, HRG1.
Usage
TSZGENE's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
