Interleukin-1 beta Rat Recombinant, IL 1 beta Rat, 10ug

Amino acid sequence
VPIRQLHCRLRDEQQKCLVLSDPCELKALHLNGQNISQQVVFSMSFVQGETSND
KIPVALGLKGLNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKT
KVEFESAQFPNWYISTSQAEHRPVFLGNSNGRDIVDFTMEPVSS.

Biological Activity
The ED50 range= 0.2-0.5 ng/ml corresponding to a specific activity of 2-5MIU/mg determined by the dose dependent proliferation of mouse D10S cells.

Description
Interleukin-1b Rat Recombinant produced in E.Coli is a non-glycosylated, Polypeptide chain containing 152 amino acids and having a molecular mass of 17.3 kDa.
The IL-1b is purified by proprietary chromatographic techniques.

Formulation
The protein was lyophilized without any additives.

Physical Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.

Protein content
Protein quantitation was carried out by two independent methods
1. UV spectroscopy at 280 nm using the absorbency value of 0.558 as the extinction coefficient for a 0.1% (1mg/ml) solution. This value is calculated by the PC GENE computer analysis program of protein sequences (IntelliGenetics).

2. Analysis by RP-HPLC, using a standard solution of IL-1b as a Reference Standard.

Purity
Greater than 95.0% as determined by SDS-PAGE.

Solubility
It is recommended to reconstitute the lyophilized Interleukin 1b in sterile 18M¦¸-cm H2O not less than 100ug/ml, which can then be further diluted to other aqueous solutions.

Source
Escherichia Coli.

Stability
Lyophilized Interleukin-1b although stable at room temperature for 3 weeks, should be stored desiccated below -18¡ãC. Upon reconstitution IL1b should be stored at 4¡ãC between 2-7 days and for future use below -18¡ãC.
For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Please prevent freeze-thaw cycles.

Synonyms
Catabolin, Lymphocyte-activating factor (LAF), Endogenous Pyrogen (EP), Leukocyte Endogenous Mediator (LEM), Mononuclear Cell Factor (MCF), IL1F2, IL-1 beta.

Usage
TSZGENE's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.