CAT No.BT-CYT-310 |
Melanoma Inhibitory Activity Human Recombinant, MIA Human, 20ug |
Physical Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.
Source
Escherichia Coli.
Amino acid sequence
Agrees with the sequence of native MIA human with an addition N-terminal Methionine residue.
MGPMPKLADRKLCADQECSSHPISMAVALQDYMAPDCRFLTIHRGQVV
YVFSLKGRGRFLWGGSVQGDYYGDLAARLGYFPSSIVREDQTLKVDVKT
DKWDFYCQ.
The biological activity is calculated by the inhibiting effect on the invasion of Mel In Tumor cells and found active in Mel In assay.
Description
Melanoma Inhibitory Activity Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain consisting of 108 amino having a total molecular mass of 12237 Dalton.
The MIA is purified by proprietary chromatographic techniques.
Formulation
The protein was lyophilized from a concentrated (1.66mg/ml) solution containing 20mM Potassium-phosphate pH=7 and 150mM potassium chloride.
Protein content
UV spectroscopy at 280 nm using the absorption coefficient of 19300 M-1cm-1 .
Purity
Greater than 95.0% as determined by(a) Analysis by RP-HPLC.
(b) Analysis by SDS-PAGE.
Solubility
It is recommended to reconstitute the lyophilized Melanoma Inhibitory Activity in sterile 18M¦¸-cm H2O not less than 100ug/ml, which can then be further diluted to other aqueous solutions.
Stability
Lyophilized MIA although stable at room temperature for 3 weeks, should be stored desiccated below -18¡ãC. Upon reconstitution MIA should be stored at 4¡ãC between 2-7 days and for future use below
-18¡ãC.
Please prevent freeze-thaw cycles.
Synonyms
Melanoma-derived growth regulatory protein precursor, Cartilage-derived retinoic acid-sensitive protein, CD-RAP, MIA.
Usage
TSZGENE's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.