B-cell Activating Factor Receptor Human Recombinant, BAFF R Human, 20ug
B-cell Activating Factor Receptor Human Recombinant, BAFF R Human, 20ug
CAT No.BT-CYT-429 |
B-cell Activating Factor Receptor Human Recombinant, BAFF R Human, 20ug |
Amino Acid Sequence
MRRGPRSLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAG
ASSPAPRTALQPQESVGAGAGEAALPLPG.
Biological Activity
Determined by its ability to block BAFF induced mouse splenocyte survival. The expected ED50 for this effect is 1000-5000ng/ml corresponding to a Specific Activity of 200-1000IU/mg in the presence of 1.0?g/ml of human soluble BAFF.
Description
B Lymphocyte Stimulator Receptor Human Recombinant extracellular produced in E.Coli is a single, non-glycosylated polypeptide chain containing 76 amino acids and having a molecular mass of 7.7 kDa.
The BAFF-R is purified by proprietary chromatographic techniques.
Formulation
Lyophilized from a 0.2¦Ìm filtered concentrated (1.0mg/ml) solution in 20mM PB, pH 8.0, 500mM NaCl.
Physical Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.
Purity
Greater than 95.0% as determined by(a) Analysis by RP-HPLC.
(b) Analysis by SDS-PAGE.
Solubility
It is recommended to reconstitute the lyophilized B Lymphocyte Stimulator Receptor Recombinant in sterile 18M¦¸-cm H2O not less than 100ug/ml, which can then be further diluted to other aqueous solutions.
Source
Escherichia Coli.
Stability
Lyophilized BAFF-R although stable at room temperature for 3 weeks, should be stored desiccated below -18¡ãC. Upon reconstitution B Lymphocyte Stimulator Receptor should be stored at 4¡ãC between 2-7 days and for future use below -18¡ãC.
Please prevent freeze-thaw cycles.
Synonyms
TNFRSF13C, CD268, BAFF-R, MGC138235, B cell-activating factor receptor.
Usage
TSZGENE's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Product features
Product features
Materials and care
Materials and care
Merchandising tips
Merchandising tips
Share


