B-cell Activating Factor Receptor Human Recombinant, BAFF R Human, 20ug

Amino Acid Sequence
MRRGPRSLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAG
ASSPAPRTALQPQESVGAGAGEAALPLPG.

Biological Activity
Determined by its ability to block BAFF induced mouse splenocyte survival. The expected ED50 for this effect is 1000-5000ng/ml corresponding to a Specific Activity of 200-1000IU/mg in the presence of 1.0?g/ml of human soluble BAFF.

Description
B Lymphocyte Stimulator Receptor Human Recombinant extracellular produced in E.Coli is a single, non-glycosylated polypeptide chain containing 76 amino acids and having a molecular mass of 7.7 kDa.
The BAFF-R is purified by proprietary chromatographic techniques.

Formulation
Lyophilized from a 0.2¦Ìm filtered concentrated (1.0mg/ml) solution in 20mM PB, pH 8.0, 500mM NaCl.

Physical Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.

Purity
Greater than 95.0% as determined by(a) Analysis by RP-HPLC.
(b) Analysis by SDS-PAGE.

Solubility
It is recommended to reconstitute the lyophilized B Lymphocyte Stimulator Receptor Recombinant in sterile 18M¦¸-cm H2O not less than 100ug/ml, which can then be further diluted to other aqueous solutions.

Source
Escherichia Coli.

Stability
Lyophilized BAFF-R although stable at room temperature for 3 weeks, should be stored desiccated below -18¡ãC. Upon reconstitution B Lymphocyte Stimulator Receptor should be stored at 4¡ãC between 2-7 days and for future use below -18¡ãC.
Please prevent freeze-thaw cycles.

Synonyms
TNFRSF13C, CD268, BAFF-R, MGC138235, B cell-activating factor receptor.

Usage
TSZGENE's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.