BCA-1/BLC Human Recombinant (CXCL13), BCA 1 Human, 20ug

CAT No.BT-CHM-348

BCA-1/BLC Human Recombinant (CXCL13), BCA 1 Human, 20ug

---

Amino acid sequence
VLEVYYTSLRCRCVQESSVFIPRRFIDRIQILPRGNG
CPRKEIIVWKKNKSIVCVDPQAEWIQRMMEVLRKR
SSSTLPVPVFKRKIP.

Biological Activity
Determined by its ability to chemoattract human B cells using a concentration range of 1-10ng/ml corresponding to a Specific Activity of 10,000-100,000IU/mg.

Description
CXCL13 Human Recombinant produced in E.Coli is a single,non-glycosylated, polypeptide chain containing 87 amino acids and having a molecular mass of 10.3 kDa.
The BCA-1 is purified by proprietary chromatographic techniques.

The BCA-1 protein was lyophilized from a concentrated (0.5mg/ml) solution containing 20mM PBS & 150mM NaCl pH-7.4.

Physical Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.

Purity
Greater than 97.0% as determined by(a) Analysis by RP-HPLC.
(b) Analysis by SDS-PAGE.

Solubility
It is recommended to reconstitute the lyophilized CXCL13 in sterile 18M¦¸-cm H2O not less than 100ug/ml, which can then be further diluted to other aqueous solutions.

Source
Escherichia Coli.

Stability
Lyophilized BCA1 although stable at room temperature for 3 weeks, should be stored desiccated below -18¡ãC. Upon reconstitution BCA1 should be stored at 4¡ãC between 2-7 days and for future use below
-18¡ãC.
For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Please prevent freeze-thaw cycles.

Synonyms
C-X-C motif chemokine 13, Small-inducible cytokine B13, B lymphocyte chemoattractant, CXC chemokine BLC, CXCL13, BCA1, BCA-1, CXCL-13, B cell Attracting Chemokine-1, BLC, ANGIE, BLR1L, SCYB13, ANGIE2.

Usage
TSZGENE's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.