Skip to product information
1 of 3

Bone Morphogenetic Protein-7 Human Recombinant, Plant, BMP 7 Human, Plant, 10ug

Bone Morphogenetic Protein-7 Human Recombinant, Plant, BMP 7 Human, Plant, 10ug

Regular price $876.00 USD
Regular price Sale price $876.00 USD
Sale Sold out
CAT No.BT-CYT-039
Bone Morphogenetic Protein-7 Human Recombinant, Plant, BMP 7 Human, Plant, 10ug

Amino acid sequence

HHHHHHSTGSKQRSQNRSKTPKNQEALRMANVAEN
SSSDQRQACKKHELYVSFRDLGWQDWIIAPEGYAAY
YCEGECAFPLNSYMNATNHAIVQTLVHFINPETVPKP
CCAPTQLNAISVLYFDDSSVILKKYRNMVVRACGCH.

Biological Activity

The biological activity of BMP-7 was measured by its ability to induce alkaline phosphatase production by ATDC5 cells, ED50 is less than 40ng/ml, corresponding to a specific activity of 25,000 units/mg.

Description

Bone Morphogenetic Protein-7 Human Recombinant produced in Plant is a monomeric, glycosylated, polypeptide chain containing 144 amino acids and having a molecular mass of 16.5kDa, and fused to a 6xHis-tag at the N-terminus.
The BMP-7 is purified by proprietary chromatographic techniques.

BMP-7 was lyophilized from a solution containing Tris-HCl 0.05M buffer at pH 7.4.

Physical Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.

Purity

Greater than 97.0% as determined by SDS-PAGE.

Solubility

Lyophilized BMP-7 protein should be reconstituted in distilled water to a concentration of 50 ng/?l.

Source
Nicotiana benthamiana.

Stability

Lyophilized BMP-7 although stable at room temperature for 3 weeks, should be stored desiccated below -18¡ãC. Upon reconstitution BMP 7 Human should be stored at 4¡ãC between 2-7 days and for future use below -18¡ãC.
For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Please prevent freeze-thaw cycles.

Synonyms
Osteogenic Protein 1, BMP-7.

Usage
TSZGENE's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.

Product features

Materials and care

Merchandising tips

View full details
Your cart
Product Product subtotal Quantity Price Product subtotal
recom_protein_p.jpg
Bone Morphogenetic Protein-7 Human Recombinant, Plant, BMP 7 Human, Plant, 10ugBT-CYT-039
Bone Morphogenetic Protein-7 Human Recombinant, Plant, BMP 7 Human, Plant, 10ugBT-CYT-039
$876.00/ea
$0.00
$876.00/ea $0.00