Ciliary Neurotrophic Factor Rat Recombinant, CNTF Rat, 20ug
Ciliary Neurotrophic Factor Rat Recombinant, CNTF Rat, 20ug
CAT No.BT-CYT-654 |
Ciliary Neurotrophic Factor Rat Recombinant, CNTF Rat, 20ug |
Amino acid sequence
AFAEQTPLTL HRRDLSSRSIWLARKIRSDLTALMESYVKHQGLNKNI
NLDSVDGVPVASTDRWSEMTEAERLQENLQAYRTFQGMLTKLLEDQRV
HFTPTEGDFHQAIHTLMLQVSAFAYQLEELMVLLEQKIPENEADGMPA
TVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRVISSHQMGISALESH
YGAKDKQM.
Biological Activity
Fully biologically active by its ability to phosphorylate STAT3 in several cells lines.
Description
CNTF Recombinant Rat produced in E.Coli is a single, non-glycosylated polypeptide chain containing 200 amino acids and having a molecular mass of 22834 Dalton.
The CNTF is purified by proprietary chromatographic techniques.
Physical Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.
Protein content
CNTF quantitation was carried out by two independent methods1. UV spectroscopy at 280 nm using the absorbency value of 1.22 as the extinction
coefficient for a 0.1% (1mg/ml) solution. This value is calculated by the PC GENE computer analysis program of protein sequences (IntelliGenetics).
2. Analysis by RP-HPLC, using a standard solution of CNTF Recombinant as a Reference Standard.
Purity
Greater than 99.0% as determined by:
(a) Analysis by Gel Filtration.
(b) Analysis by SDS-PAGE.
Solubility
It is recommended to reconstitute the lyophilized CNTF in sterile water or 0.4% NaHCO3 adjusted to pH 8-9, not less than 100ug/ml, which can then be further diluted to other aqueous solutions, preferably in presence of carrier protein.
Source
Escherichia Coli.
Stability
Lyophilized CNTF although stable at room temperature for 3 weeks, should be stored desiccated below -18¡ãC. Upon reconstitution CNTF should be stored at 4¡ãC between 2-7 days and for future use below
-18¡ãC.
Please prevent freeze-thaw cycles.
Synonyms
HCNTF, CNTF, Ciliary Neurotrophic Factor.
Usage
TSZGENE's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Product features
Product features
Materials and care
Materials and care
Merchandising tips
Merchandising tips
Share


