Skip to product information
1 of 3

Dengue Virus Subtype 4 Envelope 15kDa, C-Terminal (Domain III) Recombinant, Dengue Envelope-4 15kDa, 500ug

Dengue Virus Subtype 4 Envelope 15kDa, C-Terminal (Domain III) Recombinant, Dengue Envelope-4 15kDa, 500ug

Regular price $6,756.00 USD
Regular price Sale price $6,756.00 USD
Sale Sold out
CAT No.BT-DEN-012
Dengue Virus Subtype 4 Envelope 15kDa, C-Terminal (Domain III) Recombinant, Dengue Envelope-4 15kDa, 500ug

Sequence
SYTMCSGKFSIDKEMAETQHGTTVVKVKYEGAGAPCKVPIEIRDVNKEKV
VGRIISSTPFAEYTNSVTNIELEPFGDSYIVIGVGDSALTLHWFRKGSSIV.

Applications
Each laboratory should determine an optimum working titer for use in its particular application.

Description
The E.coli derived recombinant 12kDa protein is genetically engineered peptide which is derived from Dengue Type-2 envelope III domain immunodeterminant regions. The expressed dengue envelope Type-2 III domain peptide has 100 amino acids covering domain III region from amino acids 300-400, and is fused with a 6 His Tag. This peptide is particularly important for diagnostic and vaccine development as it contains multiple serotypes, neutralizing epitopes and receptor binding domain.

50mM sodium chloride-phosphorous buffer, pH-7.4.

Method
Purified by proprietary chromatographic technique.

Purity
Protein is >95% pure as determined by 10% PAGE (coomassie staining).

Stability
Five years frozen. One month in solution at room temperature.

Storage
Protein is shipped at ambient temperature.
Upon arrival, Store at -20¡ãC.

Usage
TSZGENE's products are furnished for LABORATORY RESEARCH USE ONLY. They may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.

Product features

Materials and care

Merchandising tips

View full details
Your cart
Product Product subtotal Quantity Price Product subtotal
recom_protein_p.jpg
Dengue Virus Subtype 4 Envelope 15kDa, C-Terminal (Domain III) Recombinant, Dengue Envelope-4 15kDa, 500ugBT-DEN-012
Dengue Virus Subtype 4 Envelope 15kDa, C-Terminal (Domain III) Recombinant, Dengue Envelope-4 15kDa, 500ugBT-DEN-012
$6,756.00/ea
$0.00
$6,756.00/ea $0.00