Skip to product information
1 of 3

Early Secretory Target Mycobacterium Tuberculosis Recombinant, ESAT6, 50ug

Early Secretory Target Mycobacterium Tuberculosis Recombinant, ESAT6, 50ug

Regular price $876.00 USD
Regular price Sale price $876.00 USD
Sale Sold out
CAT No.BT-PRO-291
Early Secretory Target Mycobacterium Tuberculosis Recombinant, ESAT6, 50ug

Amino Acid Composition
AEQQWNFAGIEAAASAIQGNVTSIHSLLDEGKQSLTKLAAAWGGSG SEAYQGVQQKWDATATELNNALQNLARTISEAGQAMASTEGNVTGMF AKLAAALEHHHHHH.

Description
ESAT-6 Recombinant produced in e.coli is a single, non-glycosylated, polypeptide having a total molecular mass of 11261.35 Dalton.
The ESAT-6 contains 6 additional amino acid residues - His-Tag.

Formulation
The protein (1mg/ml) was lyophilized after from a sterile solution containing 50mM Tris-HCl, pH 8.0, 1mM EDTA and 1mM DTT.

The sale and/or commercial use of Recombinant ESAT-6 is prohibited in the United States of America (U.S.A), Canada, Great Britain, Denmark, France, Greece, Italy, Germany, Spain, Ireland, Portugal, New Zealand and Australia.

Physical Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.

Purity
Greater than 95.0% as determined by(a) Analysis by RP-HPLC.
(b) Analysis by SDS-PAGE.

Solubility
It is recommended to reconstitute the lyophilized ESAT-6 in sterile 18M¦¸-cm H2O not less than 100ug/ml, which can then be further diluted to other aqueous solutions.

Source
Escherichia Coli.

Stability
Lyophilized ESAT-6 although stable at room temperature for 3 weeks, should be stored desiccated below -18¡ãC. Upon reconstitution ESAT-6 should be stored at 4¡ãC between 2-7 days and for future use below
-18¡ãC.
For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Please prevent freeze-thaw cycles.

Synonyms
Early Secretory Target Mycobacterium Tuberculosis, ESAT-6.

Usage
TSZGENE's products are furnished for LABORATORY RESEARCH USE ONLY. They may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.

Product features

Materials and care

Merchandising tips

View full details
Your cart
Product Product subtotal Quantity Price Product subtotal
recom_protein_p.jpg
Early Secretory Target Mycobacterium Tuberculosis Recombinant, ESAT6, 50ugBT-PRO-291
Early Secretory Target Mycobacterium Tuberculosis Recombinant, ESAT6, 50ugBT-PRO-291
$876.00/ea
$0.00
$876.00/ea $0.00