Eotaxin-2 Human Recombinant (CCL24), Eotaxin 2 Human, 20ug

CAT No.BT-CHM-238

Eotaxin-2 Human Recombinant (CCL24), Eotaxin 2 Human, 20ug

---

Amino acid sequence
VVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLKGGVIFTTKKGQQFCG
DPKQEWV QRYMKNLDAKQKKASPRARAVA.

Biological Activity
The activity is determined by the chemoattract of human PBE (peripheral blood eosinophils) at a concentration between 50-100 ng/ml corresponding to a Specific Activity of 10,000-20,000IU/mg.

Description
CCL24 Human Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 78 amino acids and having a molecular mass of 8.8 kDa.
The CCL24 is purified by proprietary chromatographic techniques.

The CCL24 protein was lyophilized from a concentrated (1mg/ml) sterile solution containing 20mM PBS pH-7.4 and 0.15M sodium chloride.

Physical Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.

Purity
Greater than 97.0% as determined by(a) Analysis by RP-HPLC.
(b) Analysis by SDS-PAGE.

Solubility
It is recommended to reconstitute the lyophilized CCL24 Human Recombinant in sterile 18M¦¸-cm H2O not less than 100ug/ml, which can then be further diluted to other aqueous solutions.

Source
Escherichia Coli.

Stability
Lyophilized Eotaxin-2 although stable at room temperature for 3 weeks, should be stored desiccated below -18¡ãC. Upon reconstitution CCL24 should be stored at 4¡ãC between 2-7 days and for future use below -18¡ãC. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Please prevent freeze-thaw cycles.

Synonyms
C-C motif chemokine 24, Small-inducible cytokine A24, Myeloid progenitor inhibitory factor 2, CK-beta-6, Eosinophil chemotactic protein 2, Eotaxin-2, CCL24, Ckb-6, MPIF2, MPIF-2, SCYA24, Eotaxin2, CCL-24.

Usage
TSZGENE products are furnished for LABORATORY RESEARCH USE ONLY. The products may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.