Skip to product information
1 of 3

Epstein-Barr Virus (HHV-4) p23 Recombinant, His Tag, EBV p23, His, 500ug

Epstein-Barr Virus (HHV-4) p23 Recombinant, His Tag, EBV p23, His, 500ug

Regular price $7,160.00 USD
Regular price Sale price $7,160.00 USD
Sale Sold out
CAT No.BT-EBV-278
Epstein-Barr Virus (HHV-4) p23 Recombinant, His Tag, EBV p23, His, 500ug

Amino Acid Sequence
SAPRKVRLPSVKAVDMSMEDMAARLARLESENKALKQ
QVLRGGACASSTSVPSAPVPPPEPLTARQREVMITQATG
RLASQAMKKIEDKVRKSVDGVTTRNEMENILQNLTLRIQ
VSMLGAKGQPSPGEGTRPRESNDPNATRRARSRSRGRE
AKKVQISD.

Applications
Antigen in ELISA and Western blots, excellent antigen for detection of HHV-4 (EBV) with minimal specificity problems.

Description
The E.Coli derived recombinant protein contains the HHV-4 p23 regions, 10- C-end amino acids having a Mw of 17.7kDa.

1xPBS pH-8 and 300mM Imidazole.

Purification Method
Purified by proprietary chromatographic technique.

Purity
Protein is >95% pure as determined by 10% PAGE (coomassie staining).

Specificity
Immunoreactive with sera of EBV-infected individuals.

Stability
Five years frozen. One month in solution at room temperature.

Storage
Protein is shipped at ambient temperature.
Upon arrival, Store at -20¡ãC.

Usage
TSZGENE's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.

Product features

Materials and care

Merchandising tips

View full details
Your cart
Product Product subtotal Quantity Price Product subtotal
recom_protein_p.jpg
Epstein-Barr Virus (HHV-4) p23 Recombinant, His Tag, EBV p23, His, 500ugBT-EBV-278
Epstein-Barr Virus (HHV-4) p23 Recombinant, His Tag, EBV p23, His, 500ugBT-EBV-278
$7,160.00/ea
$0.00
$7,160.00/ea $0.00