Skip to product information
1 of 3

FK506 Binding Protein 1A Human Recombinant, FKBP1A Human, 10ug

FK506 Binding Protein 1A Human Recombinant, FKBP1A Human, 10ug

Regular price $876.00 USD
Regular price Sale price $876.00 USD
Sale Sold out
CAT No.BT-ENZ-374
FK506 Binding Protein 1A Human Recombinant, FKBP1A Human, 10ug

Amino Acid Sequence
The amino acid sequence of recombinant His-tagged FKBP12 is reported as followingMAHHHHHHVMGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKF
DSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAY
GATGHPGIIPPHATLVFDVELLKLE.

Description
FKPB1A Human Recombinant fused to N-terminal His-Tag produced in E.Coli is a single, non-glycosylated polypeptide chain purified purified through a Ni2+-affinity chromatography followed by gel filtration.

Formulation
The FKBP1A protein solution contains 50mM Hepes pH-8.0, 150mM NaCl, 0.5mM EDTA, & 1mM sodium azide.

Sterile Filtered colorless solution.

Purity
Greater than 99.0% as determined by SDS-PAGE analysis.

Source
Escherichia Coli.

Stability
FKBP1A although stable 4¡ãC for 4 weeks, should be stored desiccated below -18¡ãC.
For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Please prevent freeze-thaw cycles.

Synonyms
FKBP12, PPIase, Peptidyl-prolyl cis-trans isomerase, Rotamase, FKBP-12, FKBP1, PKC12, PKCI2, FKBP12C, FKBP1A, PPIase FKBP1A, FK506-binding protein 1A, 12 kDa FKBP, FKBP-1A.

Usage
TSZGENE's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.

Product features

Materials and care

Merchandising tips

View full details
Your cart
Product Product subtotal Quantity Price Product subtotal
recom_protein_p.jpg
FK506 Binding Protein 1A Human Recombinant, FKBP1A Human, 10ugBT-ENZ-374
FK506 Binding Protein 1A Human Recombinant, FKBP1A Human, 10ugBT-ENZ-374
$876.00/ea
$0.00
$876.00/ea $0.00