Granulysin Human Recombinant, GNLY Human, 10ug
Granulysin Human Recombinant, GNLY Human, 10ug
| CAT No.BT-PRO-852 |
| Granulysin Human Recombinant, GNLY Human, 10ug |
Amino acid sequence
MGSSHHHHHHSSGLVPRGSHMMEGLVFSRLSPEYYD
LARAHLRDEEKSCPCLAQEGPQGDLLTKTQELGRDYR
TCLTIVQKLKKMVDKPTQRSVSNAATRVCRTGRSRWR
DVCRNFMRRYQSRVTQGLVAGETAQQICEDLRLCIPS
TGPLGSHHHHHH.
Description
GNLY Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 159 amino acids and fused to a double His Tag (N+C terminus) and having a total molecular mass of 18.1 kDa.
The GNLY is purified by proprietary chromatographic techniques.
Formulation
The Granulysin protein was lyophilized from a concentrated (1mg/ml) solution containing no additives.
Purity
Greater than 95.0% as determined by SDS-PAGE.
Solubility
It is recommended to reconstitute the lyophilized Granulysin in sterile 18M¦¸-cm H2O not less than 100ug/ml, which can then be further diluted to other aqueous solutions.
Source
Escherichia Coli.
Stability
Lyophilized Granulysin although stable at room temperature for 3 weeks, should be stored desiccated below -18¡ãC. Upon reconstitution Granulysin should be stored at 4¡ãC between 2-7 days and for future use below -18¡ãC.
For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Please prevent freeze-thaw cycles.
Synonyms
LAG2, Lymphokine LAG-2, TLA519, NKG5, LAG2, D2S69E, Granulysin, T-cell activation protein 519, GNLY, D2S69E.
Product features
Product features
Materials and care
Materials and care
Merchandising tips
Merchandising tips
Share
