Skip to product information
1 of 3

Interferon a 2a Polyclonal Rabbit Anti-Human Antibody, IFN a 2a Antibody, 20ug

Interferon a 2a Polyclonal Rabbit Anti-Human Antibody, IFN a 2a Antibody, 20ug

Regular price $876.00 USD
Regular price Sale price $876.00 USD
Sale Sold out
CAT No.BT-ANT-034
Interferon a 2a Polyclonal Rabbit Anti-Human Antibody, IFN a 2a Antibody, 20ug

Antigen Amino Acid Sequence
CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQ
IFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMNEDSILAVRKYFQR
ITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE

Applications
ELISA: to detect Human Interferon a 2a by indirect ELISA a dilution of at least 1/1,000 of this antibody is required. This antibody, in conjunction with compatible secondary reagents (anti rabbit AP conjugated), allows the detection of 0.2-1 ng /well of human Interferon a 2a.
Western Blot: to detect human Interferon a2a by WB analysis this antibody can be used in a dilution of 1/1,500.

Immunogen
IgG Anti Human Interferon a 2a is developed in rabbit using recombinant Human Interferon a 2a expressed in plants.

Lyophilized from a sterile filtered (0.2?m) solution containing phosphate buffered saline.

Purification Method
Purified IgG prepared by affinity chromatography on protein G.

Purity
Greater than 98%.

Solubility
Add distilled water at 1:2 ratio and let the lyophilized pellet dissolve completely.

Stability/Storage
Store at -20¡ãC. For long term storage freezes in working aliquots at -20¡ãC.
Repeated freezing and thawing is not recommended.

Synonyms
Leukocyte interferon, B cell interferon, Type I interferon, IFNA2, IFN-a 2a.

Type
Polyclonal Rabbit Antibody.

Usage
TSZGENE's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.

Product features

Materials and care

Merchandising tips

View full details
Your cart
Product Product subtotal Quantity Price Product subtotal
recom_protein_p.jpg
Interferon a 2a Polyclonal Rabbit Anti-Human Antibody, IFN a 2a Antibody, 20ugBT-ANT-034
Interferon a 2a Polyclonal Rabbit Anti-Human Antibody, IFN a 2a Antibody, 20ugBT-ANT-034
$876.00/ea
$0.00
$876.00/ea $0.00