Interleukin-1 beta Rat Recombinant, IL 1 beta Rat, 10ug
Interleukin-1 beta Rat Recombinant, IL 1 beta Rat, 10ug
| CAT No.BT-CYT-394 |
| Interleukin-1 beta Rat Recombinant, IL 1 beta Rat, 10ug |
Amino acid sequence
VPIRQLHCRLRDEQQKCLVLSDPCELKALHLNGQNISQQVVFSMSFVQGETSND
KIPVALGLKGLNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKT
KVEFESAQFPNWYISTSQAEHRPVFLGNSNGRDIVDFTMEPVSS.
Biological Activity
The ED50 range= 0.2-0.5 ng/ml corresponding to a specific activity of 2-5MIU/mg determined by the dose dependent proliferation of mouse D10S cells.
Description
Interleukin-1b Rat Recombinant produced in E.Coli is a non-glycosylated, Polypeptide chain containing 152 amino acids and having a molecular mass of 17.3 kDa.
The IL-1b is purified by proprietary chromatographic techniques.
Formulation
The protein was lyophilized without any additives.
Physical Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.
Protein content
Protein quantitation was carried out by two independent methods
1. UV spectroscopy at 280 nm using the absorbency value of 0.558 as the extinction coefficient for a 0.1% (1mg/ml) solution. This value is calculated by the PC GENE computer analysis program of protein sequences (IntelliGenetics).
2. Analysis by RP-HPLC, using a standard solution of IL-1b as a Reference Standard.
Purity
Greater than 95.0% as determined by SDS-PAGE.
Solubility
It is recommended to reconstitute the lyophilized Interleukin 1b in sterile 18M¦¸-cm H2O not less than 100ug/ml, which can then be further diluted to other aqueous solutions.
Source
Escherichia Coli.
Stability
Lyophilized Interleukin-1b although stable at room temperature for 3 weeks, should be stored desiccated below -18¡ãC. Upon reconstitution IL1b should be stored at 4¡ãC between 2-7 days and for future use below -18¡ãC.
For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Please prevent freeze-thaw cycles.
Synonyms
Catabolin, Lymphocyte-activating factor (LAF), Endogenous Pyrogen (EP), Leukocyte Endogenous Mediator (LEM), Mononuclear Cell Factor (MCF), IL1F2, IL-1 beta.
Usage
TSZGENE's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Product features
Product features
Materials and care
Materials and care
Merchandising tips
Merchandising tips
Share
