Macrophage Migration Inhibitory Factor Human Recombinant (Active), MIF Human, Active, 10ug

CAT No.BT-CYT-596

Macrophage Migration Inhibitory Factor Human Recombinant (Active), MIF Human, Active, 10ug

---

Amino Acid Sequence
MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLM
AFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVY
INYYDMNAANVGWNNSTFA.

Biological Activity
Human MIF biological activity was measured in an agarose microdroplet assay usinghuman U937 cells astargets.The optimal range of activity found for human MIF in this assay was 500-1,000ng/ml corresponding to a specific activity of 1,000-2,000IU/mg.

Description
MIF human Recombinant was cloned into an E.coli expression vector and was purified to apparent homogeneity by using conventional column chromatography techniques.
Macrophage Inducing Factor Human Recombinant is a single, non-glycosylated, polypeptide chain containing 115 amino acids and having a molecular mass of 12.5 kDa.

MIF-Protein was lyophilized from 10mM sodium phosphate buffer pH-7.5.

Physical Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.

Purity
Greater than 97.0% as determined by(a) Analysis by RP-HPLC.
(b) Analysis by SDS-PAGE.

Solubility
It is recommended to reconstitute the lyophilized MIF-Protein in sterile 18M¦¸-cm H2O at a concentration between 0.1mg-1mg per 1ml.

Source
Escherichia Coli.

Stability
Lyophilized MIF-protein although stable at room temperature for 3 weeks, should be stored desiccated below -18¡ãC. Upon reconstitution MIF-protein should be stored at 4¡ãC between 2-7 days and for future use below -18¡ãC.
For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Please prevent freeze-thaw cycles.

Synonyms
Phenylpyruvate tautomerase, Glycosylation-inhibiting factor, GIF, MMIF, MIF.

Usage
TSZGENE's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.