Skip to product information
1 of 3

MHC Class-I chain related gene A Human Recombinant, MICA Human, 10ug

MHC Class-I chain related gene A Human Recombinant, MICA Human, 10ug

Regular price $876.00 USD
Regular price Sale price $876.00 USD
Sale Sold out
CAT No.BT-PRO-367
MHC Class-I chain related gene A Human Recombinant, MICA Human, 10ug

Amino Acid Sequence
EPHSLRYNLTVLSWDGSVQSGFLAEVHLDGQPFLRYDRQKCRAKPQ
GQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQE
IRVCEIHEDNSTRSSQHFYYDGELFLSQNLETEEWTVPQSSRAQTLAM
NVRNFLKEDAMKTKTHYHAMHADCLQELRRYLESGVVLRRTVPPMVN
VTRSEASEGNITVTCRASSFYPRNIILTWRQDGVSLSHDTQQWGDVLP
DGNGTYQTWVATRICRGEEQRFTCYMEHSGNHSTHPVPSGKVLVLQSH.

Biological Activity
Measured by its ability to bind MICA antibody in a ELISA.

Description
MICA Human Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 320 amino acids and having a molecular mass of 36kDa.
The sequence contains the full length extracellular domain of the mature human MICA (amino acid residues Ala23 ¨C Gln308) The MICA is purified by proprietary chromatographic techniques.

Lyophilized from a concentrated (1mg/ml) solution containing no additives.

Physical Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.

Purity
Greater than 95.0% as determined by(a) Analysis by RP-HPLC.
(b) Analysis by SDS-PAGE.

Solubility
It is recommended to reconstitute the lyophilized MICA in sterile 18M¦¸-cm H2O not less than 100ug/ml, which can then be further diluted to other aqueous solutions.

Source
Escherichia Coli.

Stability
Lyophilized MICA although stable at room temperature for 3 weeks, should be stored desiccated below -18¡ãC. Upon reconstitution MICA should be stored at 4¡ãC between 2-7 days and for future use below
-18¡ãC.
For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Please prevent freeze-thaw cycles.

Synonyms
MHC class I polypeptide-related sequence A, MIC-A, MICA, PERB11.1, HLA-B, AS, HLAB, HLAC, SPDA1, HLA-B73, HLA-B-7301.

Usage
TSZGENE's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.

Product features

Materials and care

Merchandising tips

View full details
Your cart
Product Product subtotal Quantity Price Product subtotal
recom_protein_p.jpg
MHC Class-I chain related gene A Human Recombinant, MICA Human, 10ugBT-PRO-367
MHC Class-I chain related gene A Human Recombinant, MICA Human, 10ugBT-PRO-367
$876.00/ea
$0.00
$876.00/ea $0.00