Myelin Oligodendrocyte Glycoprotein Human Recombinant, MOG Human, 50ug
Myelin Oligodendrocyte Glycoprotein Human Recombinant, MOG Human, 50ug
| CAT No.BT-PRO-466 |
| Myelin Oligodendrocyte Glycoprotein Human Recombinant, MOG Human, 50ug |
Amino Acid Sequence
MGQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRN
GKDQDGDQAPEYRGRTELLKDAIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQE
EAAMELKVEDPFYWVSPGHHHHHH.
Description
Myelin Oligodendrocyte Glycoprotein produced in E.Coli is a single, non-glycosylated polypeptide chain containing 132 amino acids and having a molecular mass of 15.2 kDa.
The Myelin Oligodendrocyte Glycoprotein is fused with 6xHis tag at C-terminus.
Formulation
The Myelin Oligodendrocyte Glycoprotein 0.5mg/ml solution was lyophilized from 20mM sodium acetate buffer pH-4 and 0.3M sodium chloride.
Purity
Greater than 95.0% as determined by(a) Analysis by RP-HPLC.
(b) Analysis by SDS-PAGE.
Recommended Applications
5-20ug per ml for In-Vitro Experiments and 50-100ug per animal for In-Vivo study.
The protein can be used for T-cell proliferation, cytokine induction, antigen presentation, western blotting, ELISA and EAE induction in mice.
Solubility
It is recommended to reconstitute the lyophilized MOG in sterile 10mM Acetic acid not less than 100ug/ml, which can then be further diluted to other aqueous solutions.
Source
Escherichia Coli.
Stability
Lyophilized MOG although stable at room temperature for 3 weeks, should be stored desiccated below -18¡ãC. Upon reconstitution MOG should be stored at 4¡ãC between 2-7 days and for future use below
-18¡ãC.
For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Please prevent freeze-thaw cycles.
Synonyms
Myelin Oligodendrocyte Glycoprotein, MOG, MOGIG-2, MGC26137.
Usage
TSZGENE's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Product features
Product features
Materials and care
Materials and care
Merchandising tips
Merchandising tips
Share
