Peroxisome Proliferator Activated Receptor Gamma Human Recombinant, PPARG Human, 10ug
Peroxisome Proliferator Activated Receptor Gamma Human Recombinant, PPARG Human, 10ug
| CAT No.BT-PKA-228 |
| Peroxisome Proliferator Activated Receptor Gamma Human Recombinant, PPARG Human, 10ug |
Amino Acid Sequence
MTMVDTEMPFWPTNFGISSVDLSVMEDHSHSFDIKPFTTVDFSSISTPHY
EDIPFTRTDPVVADYKYDLKLQEYQSAIKVEPASPPYYSEKTQLYNKPHE
EPSNSLMAIECRVCGDKASGFHYGVHACEGCKGFFRRTIRLKLIYDRCD
LNCRIHKKSRNKCQYCRFQKCLAVGMSHNAIRFGRMPQAEKEKLLAEIS
SDIDQLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIY
DMNSLMMGEDKIKFKHITPLQEQSKEVAIRIFQGCQFRSVEAVQEITEYAK
SIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREF
LKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVK
PIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQV
IKKTETDMSLHPLLQEIYKDLYZ.
Description
Peroxisome Proliferator Activated Receptor Gamma Human Recombinant is expressed in E.coli having a molecular weight of 59.2 kDa and fused to an amino terminal hexahistidine tag.
Formulation
PBS 50% glycerol, 0.01% azide.
Purity
Greater than 95% as determined by SDS-PAGE.
Mass spectrometry of tryptic digest products for identity determination.
Source
Escherichia Coli.
Storage Conditions
Store at 4¡ãC if entire vial will be used within 2-4 weeks.
Store, frozen at -20¡ãC for longer periods of time.
Avoid multiple freeze-thaw cycles.
Synonyms
Peroxisome proliferator-activated receptor gamma, PPAR-gamma, PPARG, NR1C3, PPARG1, PPARG2.
Usage
TSZGENE's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Product features
Product features
Materials and care
Materials and care
Merchandising tips
Merchandising tips
Share
