Pramlintide, Pramlintide, 5mg
Pramlintide, Pramlintide, 5mg
| CAT No.BT-HOR-300 |
| Pramlintide, Pramlintide, 5mg |
Description
Pramlintide Synthetic is a single, non-glycosylated polypeptide chain containing 37 amino acids, having a molecular mass of 3949.4 Dalton and a Molecular formula of C171H267N51O53S2.
Amino Acid Composition
KCNTATCATNRLANFLVHSSNNFGPILPPTNVGSNTY-NH2.
Formulation
The protein was lyophilized with no additives.
Purity
Greater than 98.0% as determined by(a) Analysis by RP-HPLC.
(b) Analysis by SDS-PAGE.
Solubility
It is recommended to reconstitute the lyophilized Pramlintide in sterile 18M¦¸-cm H2O not less than 100 ug/ml, which can then be further diluted to other aqueous solutions. The Pramlintide is also soluble in 1% Acetic Acid.
Stability
Lyophilized Pramlintide although stable at room temperature for 3 weeks, should be stored desiccated below -18¡ãC. Upon reconstitution Pramlintide should be stored at 4¡ãC between 2-7 days and for future use below -18¡ãC.
For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Please prevent freeze-thaw cycles.
Usage
TSZGENE's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Product features
Product features
Materials and care
Materials and care
Merchandising tips
Merchandising tips
Share
