Skip to product information
1 of 3

Protein Phosphatase 1A Alpha Isoform Human Recombinant, PPM1A Human, 50ug

Protein Phosphatase 1A Alpha Isoform Human Recombinant, PPM1A Human, 50ug

Regular price $876.00 USD
Regular price Sale price $876.00 USD
Sale Sold out
CAT No.BT-PKA-222
Protein Phosphatase 1A Alpha Isoform Human Recombinant, PPM1A Human, 50ug

Activity
8,000 U/mg.

Amino Acid Sequence
MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWILMGAFLDKPKMEKHN AQGQGNGLRYGLSSMQGWRVEMEDAHTAVIGLPSGLESWSFFAVYDGHAG SQVAKYCCEHLLDHITNNQDFKGSAGAPSVENVKNGIRTG FLEIDEHMRV MSEKKHGADRSGSTAVGVLISPQHTYFINCGDSRGLLCRNRKVHFFTQDH KPSNPLEKERIQNAGGSVMIQRVNGSLAVSRALGDFDYKCVHGKGPTEQL VSPEPEVHDI ERSEEDDQFI ILACDGIWDVMGNEELCDFVRSRLEVTDDL EKVCNEVVDTCLYKGSRDNMSVILICFPNAPKVSPEAVKKEAELDKYLEC RVEEIIKKQG EGVPDLVHVM RTLASENIPSLPPGGELASKRNVIEAVYNR LNPYKNDDTDSTSTDDMW.

Description
Protein Phosphatase 1A Alpha Isoform Human Recombinant produced is a single, non-glycosylated polypeptide chain containing 382 amino acids and having a molecular mass of 46.6KDa (containing His tag, T7 gene 10 leader, XpressTM Epitope). The protein coding region of PP2C? (amino acids 1-382) was cloned into an E. coli expression vector(BamHI/Hind? site). PPM1A was overexpressed in E. coli as a soluble His-tag fusion protein, and it was purified by conventional column chromatographic techniques.

The protein (1mg/ml) In phosphate-buffered saline ( pH 7.4)

Physical Appearance
Sterile filtered colorless solution.

Purity
Greater than 95.0% as determined by(a)Analysis by RP-HPLC.
(b)Analysis by SDS-PAGE.

Source
Escherichia Coli.

Stability
Store at 4¡ãC if entire vial will be used within 2-4 weeks.
Store, frozen at -20¡ãC for longer periods of time.
For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Avoid multiple freeze-thaw cycles.

Synonyms
Protein phosphatase 1A, EC 3.1.3.16, Protein phosphatase 2C isoform alpha, PP2C-alpha, IA, PPM1A, PP2CA, MGC9201.

Unit Defenition
One unit will hydrolyze 1nanomole of p-nitrophenylphosphatate per minute at pH 7.4 at 37¡ãC using 10mM of substrate.

Usage
TSZGENE's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.

Product features

Materials and care

Merchandising tips

View full details
Your cart
Product Product subtotal Quantity Price Product subtotal
recom_protein_p.jpg
Protein Phosphatase 1A Alpha Isoform Human Recombinant, PPM1A Human, 50ugBT-PKA-222
Protein Phosphatase 1A Alpha Isoform Human Recombinant, PPM1A Human, 50ugBT-PKA-222
$876.00/ea
$0.00
$876.00/ea $0.00