Thymus & Activation Regulated Chemokine Human Recombinant (CCL17), TARC Human, 20ug

CAT No.BT-CHM-240

Thymus & Activation Regulated Chemokine Human Recombinant (CCL17), TARC Human, 20ug

---

Amino acid sequence
ARGTNVGRECCLEYFKGAIPLRKLKTWYQTSEDCSRD
AIVFVTVQGRAICSDPNNK RVKNAVKYLQSLERS.

Biological Activity
Determined by its ability to chemoattract human T-Lymphocytes using a concentration range of 1.0-10.0 ng/ml corresponding to a Specific Activity of 10,000-100,000IU/mg.

Description
CCL17 Human Recombinant produced in E.Coli is a single,non-glycosylated, polypeptide chain containing 71 amino acids and having a molecular mass of 8 kDa.
The TARC is purified by proprietary chromatographic techniques.

The protein was lyophilized from a concentrated (0.5mg/ml) solution containing 20mM PBS & 150mM NaCl pH-7.4.

Physical Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.

Purity
Greater than 97.0% as determined by(a) Analysis by RP-HPLC.
(b) Analysis by SDS-PAGE.

Solubility
It is recommended to reconstitute the lyophilized CCL17 in sterile 18M¦¸-cm H2O not less than 100ug/ml, which can then be further diluted to other aqueous solutions.

Source
Escherichia Coli.

Stability
Lyophilized TARC although stable at room temperature for 3 weeks, should be stored desiccated below -18¡ãC. Upon reconstitution TARC should be stored at 4¡ãC between 2-7 days and for future use below
-18¡ãC.
For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Please prevent freeze-thaw cycles.

Synonyms
C-C motif chemokine 17, Small-inducible cytokine A17, Thymus and activation-regulated chemokine, CC chemokine TARC, ABCD-2, CCL17, CCL-17, SCYA17, TARC, A-152E5.3, MGC138271, MGC138273.

Usage
TSZGENE's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.