Tissue Factor Pathway Inhibitor 2 Human Recombinant, TFPI2 Human, 5ug

CAT No.BT-PRO-860

Tissue Factor Pathway Inhibitor 2 Human Recombinant, TFPI2 Human, 5ug

---

Amino Acid Sequence
HHHHHHGAAQEPTGNNAEICLLPLDYGPCKALLLRYYYDRY
TQSCRQFLYGGCEGNANNFYTWEACDDACWRIEKVPKV.

Biological Activity
The activity of the TFPI2 is expressed as the amount of trypsin inhibited per milligram of TFPI2. The ability to prevent the hydrolysis of benzoyl-Larginine ethyl ester hydrochloride by trypsin is measured by spectrophotometer. 1mg TFPI2 protein will inhibit 1-1.5 mg trypsin with activity of approximately 10,000 BAEE units per mg protein.

Description
TFPI2 Human Recombinant produced in plants is a single polypeptide chain containing 79 amino acids and having a total molecular mass of 9.3kDa. The TFPI2 is fused to 6xHis Tag at N-terminus and purified by proprietary chromatographic techniques.

Lyophilized from a concentrated (1mg/ml) solution containing PBS pH-7.1.

Physical Appearence
Sterile Filtered White lyophilized (freeze-dried) powder.

Purity
Greater than 97.0% as determined by SDS-PAGE.

Solubility
It is recommended to reconstitute the lyophilized TFPI2 in sterile water & 50ug/ml BSA at a concentration of 1mg/ml, which can then be further diluted to other aqueous solutions.

Source
Nicotiana benthamiana

Stability
Lyophilized TFPI2 although stable at room temperature for 3 weeks, should be stored desiccated below -18¡ãC. Upon reconstitution TFPI2 Human should be stored at 4¡ãC between 2-7 days and for future use below -18¡ãC. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.