Transforming Growth Factor Beta 2 Human Recombinant, TGFB2 Human, 5ug
Transforming Growth Factor Beta 2 Human Recombinant, TGFB2 Human, 5ug
| CAT No.BT-CYT-441 |
| Transforming Growth Factor Beta 2 Human Recombinant, TGFB2 Human, 5ug |
Amino Acid Sequence
HHHHHHALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIH
EPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASAS
PCCVSQDLEPLTI LYYIGKTPKIEQLSNMIVKSCKCS.
Biological Activity
The biological activity of TGFB2 is measured in culture by its ability to inhibit the mink lung epithelial (Mv1Lu) cells proliferation. ED50 < 40ng/ml, corresponding to a specific activity of 25,000 units/mg.
Description
TGFB2 Human Recombinant produced in plants is a homodimeric polypeptide chain containing 2 x 118 amino acids and having a total molecular mass of 27.08kDa. The TGFB2 is fused to 6xHis Tag at N-terminus and purified by proprietary chromatographic techniques.
Physical Appearence
Sterile Filtered White lyophilized (freeze-dried) powder.
Purity
Greater than 97.0% as determined by SDS-PAGE.
Solubility
It is recommended to reconstitute the lyophilized TGFB2 in sterile 18M?-cm H2O not less than 1ug/40?l, which can then be further diluted to other aqueous solutions.
Source
Nicotiana benthamiana.
Stability
Lyophilized TGFB2 although stable at room temperature for 3 weeks, should be stored desiccated below -18¡ãC. Upon reconstitution TGFB2 Human should be stored at 4¡ãC between 2-7 days and for future use below -18¡ãC. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
Synonyms
Transforming growth factor, beta 2, cetermin, Glioblastoma-derived T-cell suppressor factor, polyergin, G-TSF, TGF-beta2, TGF-beta-2, transforming growth factor beta-2, BSC-1 cell growth inhibitor, TGFB-2.
Usage
TSZGENEs products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Product features
Product features
Materials and care
Materials and care
Merchandising tips
Merchandising tips
Share
