Trefoil Factor-1 Human Recombinant, TFF1 Human, 20ug

CAT No.BT-CYT-586

Trefoil Factor-1 Human Recombinant, TFF1 Human, 20ug

---

Amino acid sequence
EAQTETCTVAPRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFY
PNTIDVPPEEECEF.

Biological Activity
Determined by its ability to activate ERK1/2 (a MAPkinase signaling molecule) using a concentration 1,000-2,000ng/ml corresponding to a specific activity of 500-1,000IU/mg.

Description
TFF-1 Human Recombinant produced in E.Coli is a homodimer, non-glycosylated, polypeptide chain containing 2 x 60 amino acids which includes a 40 amino acid trefoil motif containing 3 conserved interamolecular disulfide bonds and having a total molecular mass of 13.2 kDa.
TFF-1 Human Recombinant is purified by proprietary chromatographic techniques.

The protein was lyophilized after dialysis against 1xPBS pH-7.4.

Physical Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.

Purity
Greater than 97.0% as determined by(a) Analysis by RP-HPLC.
(b) Analysis by SDS-PAGE.

Solubility
It is recommended to reconstitute the lyophilized TFF1 in sterile 18M¦¸-cm H2O not less than 100ug/ml, which can then be further diluted to other aqueous solutions.

Source
Escherichia Coli.

Stability
Lyophilized TFF1 although stable at room temperature for 3 weeks, should be stored desiccated below -18¡ãC. Upon reconstitution TFF1 should be stored at 4¡ãC between 2-7 days and for future use below
-18¡ãC.
For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Please prevent freeze-thaw cycles.

Synonyms
TFF-1, TFF1, pS2, BCEI, HPS, HP1.A, pNR-2, D21S21, pS2 protein, Trefoil factor 1, Breast cancer estrogen-inducible protein.

Usage
TSZGENE's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.