Trypsin Human Recombinant, Yeast, Trypsin Human, Yeast, 5mg
Trypsin Human Recombinant, Yeast, Trypsin Human, Yeast, 5mg
| CAT No.BT-PRO-786 |
| Trypsin Human Recombinant, Yeast, Trypsin Human, Yeast, 5mg |
Amino Acid Sequence
IVGGYNCEENSVPYQVSLNSGYHFCGGSLINEQWVVSAGHCYKSRIQ
VRLGEHNIEVLEGNEQFINAAKIIRHPQYDRKTLNNDIMLIKLSSRA
VINARVSTISLPTAPPATGTKCLISGWGNTASSGADYPDELQCLDAP
VLSQAKCEASYPGKITSNMFCVGFLEGGKDSCQGDSGGPVVCNGQLQ
GVVSWGDGCAQKNKPGVYTKVYNYVKWIKNTIAANS.
Biological Activity
2,500 BAEE units/mg powder.
Description
Recombinant Human Trypsin is free from any animal and human sources.
Recombinant Human Trypsin expressed in Yeast and purified by standard chromatography techniques.
Recombinant Human Trypsin is free from foreign enzymes such as carboxypeptidase A & chymotrypsin. Recombinant Human Trypsin is free from protease inhibitors such as PMSF and EDTA.
Physical Appearance
Sterile Filtered clear liquid solution.
Source
Pichia Pastoris.
Stability
Recombinant Human Trypsin should be stored at 2-8?C.
For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Usage
TSZGENE's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Product features
Product features
Materials and care
Materials and care
Merchandising tips
Merchandising tips
Share
