Skip to product information
1 of 3

Trypsin Human Recombinant, Yeast, Trypsin Human, Yeast, 5mg

Trypsin Human Recombinant, Yeast, Trypsin Human, Yeast, 5mg

Regular price $876.00 USD
Regular price Sale price $876.00 USD
Sale Sold out
CAT No.BT-PRO-786
Trypsin Human Recombinant, Yeast, Trypsin Human, Yeast, 5mg

Amino Acid Sequence
IVGGYNCEENSVPYQVSLNSGYHFCGGSLINEQWVVSAGHCYKSRIQ VRLGEHNIEVLEGNEQFINAAKIIRHPQYDRKTLNNDIMLIKLSSRA VINARVSTISLPTAPPATGTKCLISGWGNTASSGADYPDELQCLDAP VLSQAKCEASYPGKITSNMFCVGFLEGGKDSCQGDSGGPVVCNGQLQ GVVSWGDGCAQKNKPGVYTKVYNYVKWIKNTIAANS.

Biological Activity
2,500 BAEE units/mg powder.

Description
Recombinant Human Trypsin is free from any animal and human sources. Recombinant Human Trypsin expressed in Yeast and purified by standard chromatography techniques. Recombinant Human Trypsin is free from foreign enzymes such as carboxypeptidase A & chymotrypsin. Recombinant Human Trypsin is free from protease inhibitors such as PMSF and EDTA.

The protein is formulated with 1mM HCl and 20mM CaCl2, pH-3.

Physical Appearance
Sterile Filtered clear liquid solution.

Source
Pichia Pastoris.

Stability
Recombinant Human Trypsin should be stored at 2-8?C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).

Usage
TSZGENE's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.

Product features

Materials and care

Merchandising tips

View full details
Your cart
Product Product subtotal Quantity Price Product subtotal
recom_protein_p.jpg
Trypsin Human Recombinant, Yeast, Trypsin Human, Yeast, 5mgBT-PRO-786
Trypsin Human Recombinant, Yeast, Trypsin Human, Yeast, 5mgBT-PRO-786
$876.00/ea
$0.00
$876.00/ea $0.00